Recombinant Human Lymphotoxin beta Receptor is produced by our Mammalian expression system and the target gene encoding Gln31-Met227 is expressed with a 6His tag at the C-terminus.

LTBR蛋白；TNFRSF3蛋白；TNFRrpv蛋白;Tumor Necrosis Factor Receptor Superfamily Member 3; Lymphotoxin-Beta Receptor; Tumor Necrosis Factor C Receptor; Tumor Necrosis Factor Receptor 2-Related Protein; Tumor Necrosis Factor Receptor Type III; TNF-RIII; TNFR-III; LTBR; D12S370; TNFCR; TNFR3; TNFRSF3

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYL TICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEV GKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTM LMVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Tumor necrosis factor receptor superfamily member 3, also known as Lymphotoxin-beta receptor,Tumor necrosis factor C receptor,Tumor necrosis factor receptor 2-related protein,Tumor necrosis factor receptor type III,LTBR,TNFCR, TNFR3 and TNFRSF3, is a member of the tumor necrosis factor (TNF) family of receptors. LTBR is a single-pass type I membrane protein and contains four TNFR-Cys repeats. It is expressed on the surface of most cell types, but not on T and B lymphocytes. LTBR and its ligand play a role in the development and organization of lymphoid tissue and transformed cells. Activation of LTBR can trigger apoptosis. In addition, LTBR can lead to the release of the cytokine interleukin 8.

P36941